targets

Submit custom target request

Submit a new custom target (antigen) for staff review. At least one of sequence or pdb_id must be provided. The product_id must be unique within your organization.

New requests are created with pending_review status. Staff will review and approve or reject the request. Approved targets receive a material_id linking them to the catalog.

post/api/v1/targets/request-custom

Request

Base URL
https://devs.adaptyvbio.com
URL
https://devs.adaptyvbio.com/api/v1/targets/request-custom
Auth
HTTP bearer

Request body

molecular_weightnumber double nullable

Molecular weight in kilodaltons (kDa)

namestring required

Display name for the target

notestring nullable

Additional notes or context about the target

pdb_filestring nullable

Base64-encoded PDB file content for custom structures not in the PDB

pdb_idstring nullable

PDB database identifier (e.g., "1ABC", "6LU7")

product_idstring required

User-provided identifier, must be unique within your organization

product_urlstring nullable

URL to vendor product page or documentation

sequencestring nullable

Amino acid sequence using standard single-letter codes (A-Z excluding B, J, X, Z). Supports standard 20 amino acids plus selenocysteine (U) and pyrrolysine (O).

vendorstring nullable

Source vendor name if applicable

Example request

{
  "molecular_weight": 15.5,
  "name": "My Custom Antigen",
  "note": "Expressed in HEK293 cells",
  "pdb_id": "1HHO",
  "product_id": "CUSTOM-001",
  "product_url": "https://www.acrobiosystems.com/product/PD1",
  "sequence": "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH",
  "vendor": "ACRO Biosystems"
}

Response

Request submitted successfully

created_atstring date-time required

ISO 8601 timestamp when the request was created

idstring uuid required

Unique identifier assigned to the request

status'pending_review' | 'approved' | 'rejected' required

Review status for custom target requests.

Changes

No recorded changes to this operation across all 1 revision of this API.